DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and zig-4

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:183 Identity:44/183 - (24%)
Similarity:70/183 - (38%) Gaps:66/183 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 VSTHPPTSIFLHLSVVEARAEI-----TGP-PIRYLTP--------GSTLRLQCRVVQNTEASEY 311
            ::.|||....:|.:||....||     |.| .|:.:.|        |.|.:|:|.::....|:  
 Worm    14 INAHPPMHAEMHSAVVTLANEIDTNYLTSPAKIKIVAPLESALIPGGETYQLRCDIMSTPAAT-- 76

  Fly   312 IFWYHDNRMI-------------NYD---IDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVAS 360
            |.|..:.::|             |:.   :|.||        .:|.||||....|:||.::||. 
 Worm    77 IHWKFNGKLIQGSNELNVEEKLLNFGKAIVDTGI--------VASILTIQCPSAENSGTYSCVG- 132

  Fly   361 NTQPASVLVHIFKGDNPAAMYHGHVGGSTKTTQSQLHMIMIIIASGYRIFHTS 413
                                |:||     :|.::...:.:...|||.|..|.|
 Worm   133 --------------------YNGH-----QTIETVAEVEIEGEASGCRSNHKS 160

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 4/14 (29%)