DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and rig-3

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_509155.1 Gene:rig-3 / 180958 WormBaseID:WBGene00004370 Length:487 Species:Caenorhabditis elegans


Alignment Length:429 Identity:87/429 - (20%)
Similarity:146/429 - (34%) Gaps:144/429 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GRVLDRLQKPAALIFIIAYIAACGICDHTASASPGGGKTVAATMTTPASEPSVRHINQNLIMSQS 77
            ||:|.::..|.|:...::.:        :||.||...:.....:::.|.:.....|.       .
 Worm     2 GRLLAKMLFPLAMCLFVSAV--------SASDSPSSNEANPIVISSEAMDYDTNTIT-------V 51

  Fly    78 KEGEPVPVPQPYAQSAASAGGSSITSFDSTNVIDGQSQPTPTHLQEAVL--------QTHSH-SR 133
            :||:.:.|...:...........:....:.|.|||:|.|:   |...:|        :|..| |.
 Worm    52 REGKKLMVSCVFESDEQIHKSDLLWKQANGNNIDGESNPS---LFSVILNEKGSKHRKTSLHFSS 113

  Fly   134 IQAKDTAGPYPIPVHRPEPVENH-----------LEANN-----------------GIEG--GME 168
            :..:|| |.|.. ..|....||.           :|.|:                 |::|  |.|
 Worm   114 VHTRDT-GLYTC-TGRTAGGENFEKTIKLVVLPAIEWNDKDTVKGALLGEPITIDCGVKGPSGKE 176

  Fly   169 SLFGTPMYFGTE-NSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTY-----SS 227
                 ||...|. |...:..:|...|....|:..:         ||::..|||...|.     :|
 Worm   177 -----PMIQMTNGNGEPLDEEIWTIAGNEATIDSL---------KKEHAELTVSCITIEMHQETS 227

  Fly   228 DERFSATHLK--HSEDWTL-------QIKFV----QLRDAGVYECQVSTHPPTSIFLHLSVVEAR 279
            .|.|.....|  :.|.:||       .:::.    .:|||.:| |.| ||               
 Worm   228 KEEFPVVDRKDVNIEVYTLPEFETEESVQYTVIDNHVRDAIIY-CNV-TH--------------- 275

  Fly   280 AEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMI----NYDIDRGINVSTEPDFQSS 340
               :.||:|:.|                      :||.:..|    .::|...:.||     |.:
 Worm   276 ---SFPPVRHYT----------------------FYHGDEEIKMSDKFNIFVNVGVS-----QGA 310

  Fly   341 ELTIQRTRREHSGNFTCVASNTQPASV-LVHIFKGDNPA 378
            .|.|........|.:.|.|:|.:..|. .:|:.:.:.||
 Worm   311 HLKIHNVNENDLGTYKCEANNIKAKSYHTIHLREANAPA 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 25/114 (22%)
IG_like 182..262 CDD:214653 21/97 (22%)
IG_like 285..362 CDD:214653 16/80 (20%)
IGc2 292..361 CDD:197706 12/72 (17%)
rig-3NP_509155.1 IG_like 48..142 CDD:214653 22/105 (21%)
Ig 267..341 CDD:319273 24/120 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.