DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and igcm-2

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001362087.1 Gene:igcm-2 / 180913 WormBaseID:WBGene00020130 Length:802 Species:Caenorhabditis elegans


Alignment Length:406 Identity:91/406 - (22%)
Similarity:131/406 - (32%) Gaps:147/406 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 HTASASPGGGKTVAATMTTPASEPSVRHINQNLIMSQSKEGEPVPVPQPYAQSAASAGGSSITSF 104
            :|..|....|:|.::|.......|.                ||:...|| .|:.||...:::   
 Worm   278 YTCEAKNSAGETTSSTAYLHVFYPP----------------EPLSSHQP-VQTVASGRNTTV--- 322

  Fly   105 DSTNVIDGQSQPTPTHLQEA----VLQTHSHSRI---------------QAKDTAGPYPIPVHRP 150
             |.:||   :.||||....:    .|.|.:.|.|               ||.:.||...|     
 Worm   323 -SCDVI---ANPTPTSYTWSKNGHYLPTQASSHIIISYAKPGDGGIYGCQADNIAGKGSI----- 378

  Fly   151 EPVENHLEANNGIEGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGEG----VVSWIR 211
              ||.||            :...|..|.....:.:..::|....:||.    |.|    :|.|||
 Worm   379 --VETHL------------IVAEPPVFTVAPPSEIKVRLGDQVSIPCQ----GFGDPMPIVYWIR 425

  Fly   212 KKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSV- 275
            .|                       |.....||..|.|:..|.|.|||.|:....|     :|. 
 Worm   426 DK-----------------------KRINQSTLTFKKVEHLDHGAYECVVANSVET-----ISTR 462

  Fly   276 VEARAEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFW---YHDNRMINYDIDRGINVSTEPDF 337
            |....|||.|.:     .|:::..|.    ..:|..|.|   |      |...|:...|..:.| 
 Worm   463 VMLLVEITKPQM-----ASSIKFTCL----NSSSMRISWTPGY------NGGFDQTFAVHAQND- 511

  Fly   338 QSSELTIQRTRREHSGNFTCVASNTQPASVLVHIFKGDNPAAMYHGHV-----GGSTKTTQ---- 393
                :|:|.|..:.|.|.|          :|.|:    .|...|...:     .|||.:|.    
 Worm   512 ----VTLQWTSIKTSLNET----------ILDHL----EPFVSYRVSIESVNAKGSTNSTTYNRR 558

  Fly   394 --SQLHMIMIIIASGY 407
              :.||....:...||
 Worm   559 SCTSLHAPDKLYFCGY 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 23/100 (23%)
IG_like 182..262 CDD:214653 20/83 (24%)
IG_like 285..362 CDD:214653 17/79 (22%)
IGc2 292..361 CDD:197706 16/71 (23%)
igcm-2NP_001362087.1 IG_like 23..101 CDD:214653
Ig 124..200 CDD:386229
IG_like 214..298 CDD:214653 5/19 (26%)
Ig_3 309..371 CDD:372822 18/69 (26%)
Ig 389..467 CDD:386229 25/109 (23%)
FN3 476..548 CDD:238020 20/100 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.