DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and Ncam2

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001106679.1 Gene:Ncam2 / 17968 MGIID:97282 Length:837 Species:Mus musculus


Alignment Length:231 Identity:55/231 - (23%)
Similarity:83/231 - (35%) Gaps:76/231 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 GATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDA 254
            |..|.|.|.|.......|||:    ||...|   |...|.||:.  |.::   .|||..:...|.
Mouse   129 GEDAEVVCRVSSSPAPAVSWL----YHNEEV---TTIPDNRFAV--LANN---NLQILNINKSDE 181

  Fly   255 GVYECQVSTHPPTSIFLHLSVVEARAE--------ITGPPIRYLTP----------GSTLRLQCR 301
            |:|.|:             ..||||.|        |...|...:.|          |..:.|.|:
Mouse   182 GIYRCE-------------GRVEAR
GEIDFRDIIVIVNVPPAIMMPQKSFNATAERGEEMTLTCK 233

  Fly   302 VVQNTEASEYIFWYHDNRMINYD---IDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASN-- 361
            ...:.:.:  |.|:.:.::|..:   |.:|.|         :|||::....:..|::.|.|:|  
Mouse   234 ASGSPDPT--ISWFRNGKLIEENEKYILKGSN---------TELTVRNIINKDGGSYVCKATNKA 287

  Fly   362 ------------TQPASVLVHIFKGDNPAAMYHGHV 385
                        .||     ||.:..|.....:|||
Mouse   288 GEDQKQAFLQVFVQP-----HILQLKNETTSENGHV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 23/85 (27%)
IG_like 182..262 CDD:214653 23/71 (32%)
IG_like 285..362 CDD:214653 18/103 (17%)
IGc2 292..361 CDD:197706 16/81 (20%)
Ncam2NP_001106679.1 Ig1_NCAM-2 21..112 CDD:143274
I-set 22..111 CDD:254352
I-set 117..193 CDD:254352 25/88 (28%)
IGc2 128..189 CDD:197706 23/84 (27%)
Ig 208..301 CDD:299845 18/103 (17%)
I-set 215..298 CDD:254352 16/93 (17%)
Ig 300..397 CDD:299845 8/24 (33%)
IG_like 308..395 CDD:214653 4/11 (36%)
IG_like 413..491 CDD:214653
IGc2 414..482 CDD:197706
FN3 496..588 CDD:238020
fn3 594..678 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.