Sequence 1: | NP_001033956.2 | Gene: | dpr13 / 3885598 | FlyBaseID: | FBgn0034286 | Length: | 419 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001106679.1 | Gene: | Ncam2 / 17968 | MGIID: | 97282 | Length: | 837 | Species: | Mus musculus |
Alignment Length: | 231 | Identity: | 55/231 - (23%) |
---|---|---|---|
Similarity: | 83/231 - (35%) | Gaps: | 76/231 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 190 GATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDA 254
Fly 255 GVYECQVSTHPPTSIFLHLSVVEARAE--------ITGPPIRYLTP----------GSTLRLQCR 301
Fly 302 VVQNTEASEYIFWYHDNRMINYD---IDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASN-- 361
Fly 362 ------------TQPASVLVHIFKGDNPAAMYHGHV 385 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr13 | NP_001033956.2 | V-set | 180..276 | CDD:284989 | 23/85 (27%) |
IG_like | 182..262 | CDD:214653 | 23/71 (32%) | ||
IG_like | 285..362 | CDD:214653 | 18/103 (17%) | ||
IGc2 | 292..361 | CDD:197706 | 16/81 (20%) | ||
Ncam2 | NP_001106679.1 | Ig1_NCAM-2 | 21..112 | CDD:143274 | |
I-set | 22..111 | CDD:254352 | |||
I-set | 117..193 | CDD:254352 | 25/88 (28%) | ||
IGc2 | 128..189 | CDD:197706 | 23/84 (27%) | ||
Ig | 208..301 | CDD:299845 | 18/103 (17%) | ||
I-set | 215..298 | CDD:254352 | 16/93 (17%) | ||
Ig | 300..397 | CDD:299845 | 8/24 (33%) | ||
IG_like | 308..395 | CDD:214653 | 4/11 (36%) | ||
IG_like | 413..491 | CDD:214653 | |||
IGc2 | 414..482 | CDD:197706 | |||
FN3 | 496..588 | CDD:238020 | |||
fn3 | 594..678 | CDD:278470 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 764..810 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |