DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and Ncam1

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:424 Identity:91/424 - (21%)
Similarity:150/424 - (35%) Gaps:113/424 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GLYRIKNGRVLDRLQKPAALIFIIAYI-----AACGICDHTASASPGGGKTVAATMTTPAS---E 62
            |.||.: ||:|.|.:.....|.:|..:     |...|.:.||:.    |::|  |:...|.   |
Mouse   185 GTYRCE-GRILARGEINFKDIQVIVNVPPTVQARQSIVNATANL----GQSV--TLVCDADGFPE 242

  Fly    63 PSVRHINQNLIMSQSKEGEPVPVPQPYAQSAASAGGSSITSFDSTNV----IDGQSQPTPTHLQE 123
            |:         ||.:|:|||:       ::........|.|.||:.:    :|...:.....:  
Mouse   243 PT---------MSWTKDGEPI-------ENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCI-- 289

  Fly   124 AVLQTHSHSRIQAKDTAGPYPIPVHRPEPVENHLEANNGIEGGMESLFGTPMYFGTENSTVVTTQ 188
                        |::.||.....:|.                   .:|..|.....||.|.:..:
Mouse   290 ------------AENKAGEQDASIHL-------------------KVFAKPKITYVENQTAMELE 323

  Fly   189 IGATAHVPCTVHHIGEGV--VSWIRKKDYHLLTVGLTTYSSDERFSAT----------HL---KH 238
                ..|..|....|:.:  ::|         .......||:|:.|.|          |:   .|
Mouse   324 ----EQVTLTCEASGDPIPSITW---------RTSTRNISSEEKASWTRPEKQETLDGHMVVRSH 375

  Fly   239 SEDWTLQIKFVQLRDAGVYECQVST---HPPTSIFLHLSVVEARAEITGPPIRYLTPGSTLRLQC 300
            :...:|.:|.:|..|||.|.|..|.   ....|::|.   |:...::.||...|...|:.:.:.|
Mouse   376 ARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLE---VQYAPKLQGPVAVYTWEGNQVNITC 437

  Fly   301 RVVQNTEASEYIFWYHDNRMI---NYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASNT 362
            .|.....|:  |.|:.|.:::   ||.   .|.:...|  .:|.|.:........||:.|.|.|.
Mouse   438 EVFAYPSAT--ISWFRDGQLLPSSNYS---NIKIYNTP--SASYLEVTPDSENDFGNYNCTAVNR 495

  Fly   363 QPASVLVHIF-KGDNPAAMYHGHVGGSTKTTQSQ 395
            .....|..|. :.|.|::.....|...:.|.|.|
Mouse   496 IGQESLEFILVQADTPSSPSIDRVEPYSSTAQVQ 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 25/113 (22%)
IG_like 182..262 CDD:214653 20/94 (21%)
IG_like 285..362 CDD:214653 19/79 (24%)
IGc2 292..361 CDD:197706 17/71 (24%)
Ncam1XP_006510118.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652 3/4 (75%)
Ig3_NCAM-1_like 211..308 CDD:143207 26/151 (17%)
Ig_NCAM-1 307..413 CDD:143277 26/121 (21%)
Ig_3 417..494 CDD:372822 20/83 (24%)
FN3 509..606 CDD:238020 6/21 (29%)
fn3 649..731 CDD:365830
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.