DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and zig-8

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:222 Identity:53/222 - (23%)
Similarity:93/222 - (41%) Gaps:46/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 NSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQ 245
            :.|:|.......|::.|:|....|..::|.|..|..|||.|..|::.|.|:..:. |.:..|.|.
 Worm    41 SQTIVNVVAENPAYLHCSVPPDAEHEIAWTRVSDGALLTAGNRTFTRDPRWQVSK-KSANIWVLN 104

  Fly   246 IKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPPIRYLTPGSTLRLQCRVVQNTEASE 310
            ::..:.:|:|.|.|:::....|...::|.|:|       ||:.  :|.|..:...:::.|....|
 Worm   105 LRRAEQQDSGCYLCEINDKHNTVYAVYLKVLE-------PPLP--SPSSLQKKSTKLMANMSGDE 160

  Fly   311 YIF-----------------WYHDNRMINYD----------IDRGINVSTEPDFQSSELTIQRTR 348
            .:.                 |..|...||::          .|.|:.:.|        :.|::..
 Worm   161 VVLNCTVTSTDKDEEVLDVVWTRDGNTINFNDTEKYILKVKRDAGVVIET--------MRIRKAT 217

  Fly   349 REHSGNFTCVASNTQPASVLVHIFKGD 375
            .|..||:.|..|. |.||.:|||.|.:
 Worm   218 MEDDGNYACEHSQ-QKASQIVHINKAE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 25/94 (27%)
IG_like 182..262 CDD:214653 23/79 (29%)
IG_like 285..362 CDD:214653 19/103 (18%)
IGc2 292..361 CDD:197706 16/95 (17%)
zig-8NP_499714.1 IG_like 55..134 CDD:214653 22/79 (28%)
Ig 55..129 CDD:143165 21/74 (28%)
ig 158..229 CDD:278476 13/78 (17%)
IG_like 158..227 CDD:214653 12/76 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I7153
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.