DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and Kirrel

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_011238330.1 Gene:Kirrel / 170643 MGIID:1891396 Length:805 Species:Mus musculus


Alignment Length:207 Identity:58/207 - (28%)
Similarity:84/207 - (40%) Gaps:31/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 SLFGTPMYFGTE--NSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTV--GLTTYSSDE 229
            :|.||...|..|  :.|||.   |..|.:||.:.:. .|:|.|  .||...|.:  ||..:   .
Mouse    47 ALPGTQTRFSQEPADQTVVA---GQRAVLPCVLLNY-SGIVQW--TKDGLALGMGQGLKAW---P 102

  Fly   230 RFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVV----EARAEITGPPIRYL 290
            |:.......:..:.|:|...:|.|...||||.:.....|....|:|:    |.|  |.|.|:..|
Mouse   103 RYRVVGSADAGQYNLEITDAELSDDASYECQATEAALRSRRAKLTVLIPPEETR--IDGGPVILL 165

  Fly   291 TPGSTLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTE------PDFQSSELTIQRTRR 349
            ..|:...|.||.. |.:.:..|.|:.|...     ..|...|||      .:...|:|.|:.|..
Mouse   166 QAGTPYNLTCRAF-NAKPAATIIWFRDGTQ-----QEGAVTSTELLKDGKRETTISQLLIEPTDL 224

  Fly   350 EHSGNFTCVASN 361
            :....|||.:.|
Mouse   225 DIGRVFTCRSMN 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 27/99 (27%)
IG_like 182..262 CDD:214653 24/81 (30%)
IG_like 285..362 CDD:214653 22/83 (27%)
IGc2 292..361 CDD:197706 19/74 (26%)
KirrelXP_011238330.1 Ig 54..148 CDD:386229 28/102 (27%)
Ig2_KIRREL3-like 170..251 CDD:143236 19/73 (26%)
Ig 255..336 CDD:386229
Ig_3 340..421 CDD:372822
Ig5_KIRREL3 439..536 CDD:143306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.