DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and Cd86

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_006521804.1 Gene:Cd86 / 12524 MGIID:101773 Length:314 Species:Mus musculus


Alignment Length:181 Identity:45/181 - (24%)
Similarity:74/181 - (40%) Gaps:30/181 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LFGTPMYFGTENSTVVTTQIGATAHVPCTVH-----HIGEGVVSWIRKKDYHLLTVGLTTYSSDE 229
            :|.|.:......|.........||::||...     .:.|.||.|   :|...|.: ...|...|
Mouse    18 IFVTVLLISDAVSVETQAYFNGTAYLPCPFTKAQNISLSELVVFW---QDQQKLVL-YEHYLGTE 78

  Fly   230 RFSATHLKH-------SEDWTLQIKFVQLRDAGVYECQVSTHPPT-SIFLHLSVVEAR--AEITG 284
            :..:.:.|:       ..:|||::..||::|.|.|:|.:...||| ||.|..::.|..  |..:.
Mouse    79 KLDSVNAKYLGRTSFDRNNWTLRLHNVQIKDMGSYDCFIQKKPPTGSIILQQTLTELSVIANFSE 143

  Fly   285 PPIRY---LTPGSTLRLQCRVVQNTEASEYIFW--------YHDNRMINYD 324
            |.|:.   :|..|.:.|.|...|.....:.:::        |.||..|:.|
Mouse   144 PEIKLAQNVTGNSGINLTCTSKQGHPKPKKMYFLITNSTNEYGDNMQISQD 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 29/108 (27%)
IG_like 182..262 CDD:214653 23/91 (25%)
IG_like 285..362 CDD:214653 12/51 (24%)
IGc2 292..361 CDD:197706 9/41 (22%)
Cd86XP_006521804.1 IgV_CD86 33..138 CDD:319336 29/108 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.