DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and Opcml

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:187 Identity:48/187 - (25%)
Similarity:81/187 - (43%) Gaps:35/187 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 VTTQIGATAHVPCTVHHIGEGV--VSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIK 247
            ||.:.|.:|.:.||   |.:.|  |:|:.:..  :|..|...:|.|.|.... :.....:::.|:
  Rat    45 VTVRQGESATLRCT---IDDRVTRVAWLNRST--ILYAGNDKWSIDPRVIIL-VNTPTQYSIMIQ 103

  Fly   248 FVQLRDAGVYECQVST--HPPTSIFLHL------SVVEARAEITGPPIRYLTPGSTLRLQCRVVQ 304
            .|.:.|.|.|.|.|.|  ||.|| .:||      .::...::||      :..||::.|.|..:.
  Rat   104 NVDVYDEGPYTCSVQTDNHPKTS-RVHLIV
QVPPQIMNISSDIT------VNEGSSVTLLCLAIG 161

  Fly   305 NTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASN 361
            ..|.:  :.|.|      ..:..|....:|.::    |.|...:|:.||.:.|.|.|
  Rat   162 RPEPT--VTWRH------LSVKEGQGFVSEDEY----LEISDIKRDQSGEYECSALN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 29/100 (29%)
IG_like 182..262 CDD:214653 21/78 (27%)
IG_like 285..362 CDD:214653 17/77 (22%)
IGc2 292..361 CDD:197706 16/68 (24%)
OpcmlXP_017450901.1 Ig 44..132 CDD:416386 29/93 (31%)
Ig strand A' 44..49 CDD:409353 2/3 (67%)
Ig strand B 51..59 CDD:409353 3/10 (30%)
CDR1 59..63 CDD:409353 1/3 (33%)
FR2 64..70 CDD:409353 2/5 (40%)
Ig strand C 64..70 CDD:409353 2/5 (40%)
CDR2 71..83 CDD:409353 2/13 (15%)
Ig strand C' 72..76 CDD:409353 0/5 (0%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 8/34 (24%)
Ig strand D 87..94 CDD:409353 1/7 (14%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 5/9 (56%)
FR4 125..132 CDD:409353 4/7 (57%)
Ig_3 135..206 CDD:404760 18/88 (20%)
Ig strand A 135..138 CDD:409353 0/2 (0%)
Ig strand A' 144..148 CDD:409353 2/9 (22%)
Ig strand B 151..160 CDD:409353 3/8 (38%)
Ig strand C 165..170 CDD:409353 0/6 (0%)
Ig strand C' 171..174 CDD:409353 1/8 (13%)
Ig strand F 198..206 CDD:409353 3/7 (43%)
Ig_3 223..300 CDD:404760
putative Ig strand A 224..230 CDD:409353
Ig strand B 240..244 CDD:409353
Ig strand C 253..257 CDD:409353
Ig strand E 279..283 CDD:409353
Ig strand F 293..298 CDD:409353
Ig strand G 306..309 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.