DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and iglon5

DIOPT Version :10

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_002938252.1 Gene:iglon5 / 100488314 XenbaseID:XB-GENE-945713 Length:333 Species:Xenopus tropicalis


Alignment Length:252 Identity:62/252 - (24%)
Similarity:94/252 - (37%) Gaps:62/252 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 SRIQ-AKDTAGPYPIPVHRPEPVENHLEANNGIEGGMESLFGTPMYFGTENSTVVTTQIGATAHV 195
            ||:| ..:|...|.|       |..|::..:      |.|:  ...|.||:.. .|:|:.....|
 Frog    77 SRVQLLTNTKSEYSI-------VITHVDVAD------EGLY--TCSFQTEDKP-HTSQVYLIVQV 125

  Fly   196 PCTVHHIGEGV-VSWIRKKDYHLLTVG-----LTTYSSDERFSATHLKHSEDWTLQIKFVQLRDA 254
            |..:.:|...| |:.....:...|.||     :|.....|.||      ||...|:|..:..:.|
 Frog   126 PAKIVNISSSVTVNEGSNVNLQCLAVGKPEPTITWQQLSEGFS------SEGELLEITEINRQQA 184

  Fly   255 GVYECQVS---------------THPPTSIFLHLSVVEARAEITGPPIRYLTPGSTLRLQCRVVQ 304
            |.|||..|               .:||     :::.|:......|.|       :|||.:...|.
 Frog   185 GDYECVTSNGVSVPDTKKVQITVNYPP-----YITDVKNAQSPVGRP-------ATLRCKAMAVP 237

  Fly   305 NTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASN 361
            ..|..    ||.|.:........|:::.||..:  |.:........|.||:||:|||
 Frog   238 PAEFE----WYKDEKRRLISGTEGLSIKTESSW--SVIVFSNVTSRHYGNYTCLASN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:462230 27/116 (23%)
Ig_3 281..361 CDD:464046 20/79 (25%)
iglon5XP_002938252.1 Ig 31..123 CDD:472250 15/61 (25%)
Ig strand B 44..48 CDD:409353
Ig strand C 56..60 CDD:409353
Ig strand E 89..93 CDD:409353 2/10 (20%)
Ig strand F 103..108 CDD:409353 1/6 (17%)
Ig strand G 116..119 CDD:409353 1/2 (50%)
Ig 122..207 CDD:472250 22/90 (24%)
Ig strand B 144..148 CDD:409353 0/3 (0%)
Ig strand C 157..160 CDD:409353 0/2 (0%)
Ig strand E 172..176 CDD:409353 1/3 (33%)
Ig strand F 186..191 CDD:409353 3/4 (75%)
Ig strand G 200..203 CDD:409353 0/2 (0%)
Ig_3 210..288 CDD:464046 23/95 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.