DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and cd86

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_017946874.1 Gene:cd86 / 100486350 XenbaseID:XB-GENE-22065593 Length:319 Species:Xenopus tropicalis


Alignment Length:257 Identity:49/257 - (19%)
Similarity:85/257 - (33%) Gaps:68/257 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 EANNGIEGGMESLFGTPMYFGTENSTVVTTQIGATAHVPC--------TVHHIGEGVVSWIRKKD 214
            :|...:|.| |:|:|.........||.::.|      .|.        |:.::.:||......||
 Frog    20 DAPRSMESG-EALYGGTAGLKCSPSTNLSLQ------KPSFYWQNEVETIFNVDDGVPDLQHVKD 77

  Fly   215 YHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSV--VE 277
            .:...:.|                .|:|.|.:..|.:.|.|.|...:....|.....|:.|  ::
 Frog    78 KYKNRIAL----------------KENWDLYLHNVTVEDEGEYSNYIIKKTPWREHAHICVFRLK 126

  Fly   278 ARA-----EITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMIN--------------- 322
            .||     |....|....|.|....|:|.:.........:.|    |::|               
 Frog   127 VRAHFSPTESHSSPTHNTTRGEDKTLECSLAGGYPKPSGLMW----RVVNSSGTFTMKENFSISE 187

  Fly   323 ------YDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVA-----SNTQPASVLVHIFK 373
                  |:|...::|..|.:...|.|.::..:...:..|:.:.     |:|.|..|...:.|
 Frog   188 DVETKLYNISSSLSVMVEGNTTISCLILKGGQTTDTYEFSIIVDPENISSTVPPVVTPPVMK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 20/105 (19%)
IG_like 182..262 CDD:214653 17/87 (20%)
IG_like 285..362 CDD:214653 16/102 (16%)
IGc2 292..361 CDD:197706 13/94 (14%)
cd86XP_017946874.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051626at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.