DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and kirrel1b

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b / 100170816 ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio


Alignment Length:277 Identity:68/277 - (24%)
Similarity:100/277 - (36%) Gaps:87/277 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 IGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVG--LTTYSSDERFSATHLKHSEDWTLQIKFVQL 251
            ||....:.|.|.:. .|:|.|  .||...|.:|  |..:   .|:....:.....:.|:|....|
Zfish    38 IGERVVLSCVVFNY-TGIVQW--TKDGLALGIGEDLRAW---PRYRVLRIMDVGQYNLEITSADL 96

  Fly   252 RDAGVYECQVSTHPPTSIFLHLSVVEARAEIT-----------GPPIRYLTPGSTLRLQCRVVQN 305
            .|..:||||.:         ..::...||::|           |.|...||.|::..|.| |.:.
Zfish    97 TDDSLYECQAT---------EAALRSRRAKLTVLIPPDGPVIEGSPEILLTAGTSFNLTC-VSRG 151

  Fly   306 TEASEYIFWYHDNRMINYDIDRGINVSTE--PDFQ----SSELTIQRTRREHSGNFTCVASNT-- 362
            .:....|.||.|..::     .|.:.|||  .|.:    .|.|.||....:...||||||||.  
Zfish   152 AKPMSTIEWYKDGIIV-----EGAHTSTEVLSDRKRVTTKSFLEIQPMDTDTGRNFTCVASNLAA 211

  Fly   363 -------------QPASVLVHI-----FKGD----------NPAAM-YHGHVGGSTKTTQSQLHM 398
                         .|.:|::.|     .:|:          ||..| |....||           
Zfish   212 PLGKRSTVTLNIHHPPTVILSIEPRSVLEGERVKFTCQATANPPIMGYRWAKGG----------- 265

  Fly   399 IMIIIASGYR--IFHTS 413
               :|..|.|  :|.|:
Zfish   266 ---VILDGARESVFETT 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 21/88 (24%)
IG_like 182..262 CDD:214653 21/74 (28%)
IG_like 285..362 CDD:214653 27/82 (33%)
IGc2 292..361 CDD:197706 23/74 (31%)
kirrel1bXP_017212964.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.