DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and timd4

DIOPT Version :10

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001116089.3 Gene:timd4 / 100142639 ZFINID:ZDB-GENE-080303-10 Length:259 Species:Danio rerio


Alignment Length:111 Identity:23/111 - (20%)
Similarity:40/111 - (36%) Gaps:21/111 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 YLTPGSTLRLQCRVVQNTEASEYIFWYHD------NRMINYDIDRGINVSTEPD---------FQ 338
            ::|.|||:.|.|..........::.|..|      |.:|....:.|: :|...|         ..
Zfish    29 HVTEGSTVILSCHYSVKHHGLSHVCWGRDCGTFWCNDIIVQTDEYGV-ISKVSDRYRLIGDVMLG 92

  Fly   339 SSELTIQRTRREHSGNFTCVAS-----NTQPASVLVHIFKGDNPAA 379
            ..:|.||:.::..||.:.|...     |.:..|..:.:.|.....|
Zfish    93 QMDLGIQKIQKSDSGPYCCRVDIEGFFNDKKMSYTLQVMKAPTTVA 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:462230
Ig_3 281..361 CDD:464046 19/91 (21%)
timd4NP_001116089.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.