Sequence 1: | NP_001033956.2 | Gene: | dpr13 / 3885598 | FlyBaseID: | FBgn0034286 | Length: | 419 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031755650.1 | Gene: | negr1 / 100127726 | XenbaseID: | XB-GENE-987949 | Length: | 388 | Species: | Xenopus tropicalis |
Alignment Length: | 269 | Identity: | 62/269 - (23%) |
---|---|---|---|
Similarity: | 95/269 - (35%) | Gaps: | 102/269 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 190 GATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFS-ATHLKHSEDWTLQIKFVQLRD 253
Fly 254 AGVYECQVST-HPPTSIFLHLSV--------------------VEARAEITGPP-----IRYLTP 292
Fly 293 -----GSTLRLQCRVVQNTEASEY----------------------------------------- 311
Fly 312 -----------IF-WYHDNRMINYDIDRGI---NVSTEPDFQSSELTIQRTRREHSGNFTCVASN 361
Fly 362 ---TQPASV 367 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr13 | NP_001033956.2 | V-set | 180..276 | CDD:284989 | 28/107 (26%) |
IG_like | 182..262 | CDD:214653 | 21/72 (29%) | ||
IG_like | 285..362 | CDD:214653 | 28/145 (19%) | ||
IGc2 | 292..361 | CDD:197706 | 25/129 (19%) | ||
negr1 | XP_031755650.1 | Ig | 44..136 | CDD:416386 | 27/86 (31%) |
FR1 | 44..62 | CDD:409353 | 3/7 (43%) | ||
Ig strand A' | 47..53 | CDD:409353 | |||
Ig strand B | 55..63 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 63..68 | CDD:409353 | 1/5 (20%) | ||
FR2 | 69..75 | CDD:409353 | 1/5 (20%) | ||
Ig strand C | 69..74 | CDD:409353 | 1/4 (25%) | ||
CDR2 | 76..87 | CDD:409353 | 1/12 (8%) | ||
Ig strand C' | 78..82 | CDD:409353 | 0/3 (0%) | ||
Ig strand C' | 84..87 | CDD:409353 | 0/2 (0%) | ||
FR3 | 88..122 | CDD:409353 | 13/35 (37%) | ||
Ig strand D | 91..98 | CDD:409353 | 4/6 (67%) | ||
Ig strand E | 101..107 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 114..122 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 123..127 | CDD:409353 | 2/3 (67%) | ||
Ig strand G | 127..136 | CDD:409353 | 3/8 (38%) | ||
FR4 | 129..136 | CDD:409353 | 2/6 (33%) | ||
Ig_3 | 140..208 | CDD:404760 | 11/67 (16%) | ||
Ig strand A' | 146..151 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 157..164 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 170..175 | CDD:409353 | 0/4 (0%) | ||
Ig strand C' | 177..179 | CDD:409353 | 0/1 (0%) | ||
Ig strand E | 187..193 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 200..207 | CDD:409353 | 1/6 (17%) | ||
Ig strand G | 214..222 | CDD:409353 | 0/7 (0%) | ||
Ig_3 | 226..302 | CDD:404760 | 19/81 (23%) | ||
putative Ig strand A | 226..232 | CDD:409353 | 0/5 (0%) | ||
Ig strand B | 242..246 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 255..259 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 281..285 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 295..300 | CDD:409353 | 3/4 (75%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |