DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33998 and CG13323

DIOPT Version :9

Sequence 1:NP_001033959.1 Gene:CG33998 / 3885594 FlyBaseID:FBgn0053998 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001286370.1 Gene:CG13323 / 36433 FlyBaseID:FBgn0033788 Length:112 Species:Drosophila melanogaster


Alignment Length:124 Identity:31/124 - (25%)
Similarity:55/124 - (44%) Gaps:19/124 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIYVILLVFALTAFAAASGRGRSHSITWGARTYRDMHLHREIITE-----KSKFLRV-VTREFV 59
            |::.:||.|........     .::..|||.|...|..|.|  .||     |:.:..| |.....
  Fly     1 MRLLLILSVVLAVILGC-----HAYGATWGRRNNNDYLLSR--TTEVRNPIKNNYWNVNVNYPAG 58

  Fly    60 FDQKKLARTITQIVITDQIRDGNGGYAYLTAGGPQTTYAKIHLKSQRNQGFSFIIDIYG 118
            |      ..|:.:::.|..::.:|....|.:|||...:|.::|:.|.|:|.:..::|:|
  Fly    59 F------YNISAVIVYDNFKNNSGASPSLYSGGPGYRFATVNLRGQVNRGINSTVEIWG 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33998NP_001033959.1 MBF2 29..118 CDD:292493 25/94 (27%)
CG13323NP_001286370.1 MBF2 24..111 CDD:292493 25/94 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471751
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138395at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR37685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.