DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33998 and CG31789

DIOPT Version :10

Sequence 1:NP_001033959.1 Gene:CG33998 / 3885594 FlyBaseID:FBgn0053998 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_724118.1 Gene:CG31789 / 318943 FlyBaseID:FBgn0051789 Length:117 Species:Drosophila melanogaster


Alignment Length:38 Identity:11/38 - (28%)
Similarity:17/38 - (44%) Gaps:2/38 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 LFTLLQHSTTDGEEQLLSRKQETEAANKSVEEALTAPS 285
            :|.||  |.:.|.|.:.:|.|...:|.....|....|:
  Fly    36 MFVLL--SCSSGREFMPTRVQLNLSARAKRREINVVPT 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33998NP_001033959.1 MBF2 29..118 CDD:464913
CG31789NP_724118.1 MBF2 24..114 CDD:464913 11/38 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.