| Sequence 1: | NP_001033964.1 | Gene: | CG34029 / 3885592 | FlyBaseID: | FBgn0054029 | Length: | 114 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001015947.2 | Gene: | fam76b / 548701 | XenbaseID: | XB-GENE-5850810 | Length: | 337 | Species: | Xenopus tropicalis |
| Alignment Length: | 67 | Identity: | 21/67 - (31%) |
|---|---|---|---|
| Similarity: | 36/67 - (53%) | Gaps: | 2/67 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 8 LYMCTACFKRFLWSELSRKELRCAQCRLSTKI--CVICDKKFEPREMSQVYCKQCNFYIERHAVV 70
Fly 71 KP 72 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG34029 | NP_001033964.1 | FAM76 | 8..>64 | CDD:464993 | 19/57 (33%) |
| fam76b | NP_001015947.2 | FAM76 | 5..326 | CDD:464993 | 21/67 (31%) |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 143..241 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||