DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34029 and fam76b

DIOPT Version :10

Sequence 1:NP_001033964.1 Gene:CG34029 / 3885592 FlyBaseID:FBgn0054029 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001015947.2 Gene:fam76b / 548701 XenbaseID:XB-GENE-5850810 Length:337 Species:Xenopus tropicalis


Alignment Length:67 Identity:21/67 - (31%)
Similarity:36/67 - (53%) Gaps:2/67 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYMCTACFKRFLWSELSRKELRCAQCRLSTKI--CVICDKKFEPREMSQVYCKQCNFYIERHAVV 70
            ||.||.|.:|:.:.|||:.:..|.:||::..|  |..|..:|:....:...||:|...:::....
 Frog     5 LYACTKCHQRYPFEELSQGQQLCKECRIAHPIVKCTYCRSEFQQESKTNTICKKCAQNVKQFGTP 69

  Fly    71 KP 72
            ||
 Frog    70 KP 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34029NP_001033964.1 FAM76 8..>64 CDD:464993 19/57 (33%)
fam76bNP_001015947.2 FAM76 5..326 CDD:464993 21/67 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..241
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.