DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34029 and CG4452

DIOPT Version :10

Sequence 1:NP_001033964.1 Gene:CG34029 / 3885592 FlyBaseID:FBgn0054029 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_648303.1 Gene:CG4452 / 39069 FlyBaseID:FBgn0035981 Length:390 Species:Drosophila melanogaster


Alignment Length:78 Identity:27/78 - (34%)
Similarity:39/78 - (50%) Gaps:14/78 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYMCTACFKRFLWSELSRKELRCAQCRLSTKI--CVICDKKFEPREMSQVYCKQCNFYIERHAVV 70
            |:.|:.||.|.|:.|||..:..|..||.||.:  |..|..:|:|...||..||:|..|:.::   
  Fly     6 LFACSKCFSRHLYEELSSGQQLCKGCRGSTSVGKCTYCRSEFQPATKSQSACKKCEHYLGKY--- 67

  Fly    71 KPPPLGVQIGKPA 83
                     |||:
  Fly    68 ---------GKPS 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34029NP_001033964.1 FAM76 8..>64 CDD:464993 23/57 (40%)
CG4452NP_648303.1 FAM76 6..310 CDD:464993 27/78 (35%)

Return to query results.
Submit another query.