DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34029 and FAM76A

DIOPT Version :10

Sequence 1:NP_001033964.1 Gene:CG34029 / 3885592 FlyBaseID:FBgn0054029 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001137384.1 Gene:FAM76A / 199870 HGNCID:28530 Length:341 Species:Homo sapiens


Alignment Length:68 Identity:19/68 - (27%)
Similarity:33/68 - (48%) Gaps:8/68 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LYMCTACFKRFLWSELSRKELRCAQCRLSTKI--CVICDKKFEPREMSQVYCKQCNFYIERHAVV 70
            ||.||.|.:||.:..||:.:..|.:||::..:  |..|..:::...:      :||..|..|..:
Human     4 LYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQERL------ECNGTISAHCNL 62

  Fly    71 KPP 73
            ..|
Human    63 HLP 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34029NP_001033964.1 FAM76 8..>64 CDD:464993 16/57 (28%)
FAM76ANP_001137384.1 FAM76 4..326 CDD:464993 19/68 (28%)

Return to query results.
Submit another query.