DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and CG13250

DIOPT Version :9

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:152 Identity:30/152 - (19%)
Similarity:59/152 - (38%) Gaps:20/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQFGLYKRLNGY-KPF- 88
            :.:.::.|..:|...:....|.:..:.:..........||:..|||:.|:..:.:..|.. :|. 
  Fly    33 IRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRSVTKMWVELSVGQIANRKDRPVQ 97

  Fly    89 -LYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEMSYHSINYKLTEILPF 152
             |:.:.:|||..::.|:.:.|.....:......|....||     :|..::|.|..:.|.     
  Fly    98 QLFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDACP-----LLANVNYTSTRFALN----- 152

  Fly   153 PEGNYKLEVHWIAYDIDRAITT 174
            |:       |:.||..|....|
  Fly   153 PD-------HFPAYMPDMKFNT 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 17/87 (20%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 20/90 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472654
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.