DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and CG33769

DIOPT Version :9

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster


Alignment Length:120 Identity:28/120 - (23%)
Similarity:46/120 - (38%) Gaps:22/120 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NRSYKYVSLKVKLLKIPVTK----IKVQFGLYKRLNGYKPF--LYNMTLDGCRFLKSRNPNPIAL 110
            |.|.:.:..||.:..|.||.    :|.......||...||:  :|...::.|..:|....:....
  Fly    43 NFSIQIIKTKVIMDMILVTTLRQGLKAHLSFEFRLTKAKPYQSVYQHDMNYCALIKGSQESIYRR 107

  Fly   111 YFYNLFKDYSNINHTCP------YNHDLVLDEMSYHSINYKLTEILPFPEGNYKL 159
            :|.::.| ..|...:||      |.|...||..:..|..|.         |:|::
  Fly   108 WFTSMLK-VGNFATSCPIREGYYYLHGWTLDANNVPSFLYL---------GDYRI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 20/92 (22%)
CG33769NP_001027143.1 DM8 82..173 CDD:214778 17/81 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448011
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.