DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and CG33914

DIOPT Version :10

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster


Alignment Length:175 Identity:58/175 - (33%)
Similarity:102/175 - (58%) Gaps:12/175 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LICIYYLTEVYSL-VEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQF 76
            |:|:.:|||::.: :.||||.||:.|...|:.|||.:.:::::...:||:..:||...|.|::.|
  Fly    12 LLCLLFLTELHGVFMRFTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAMLKPMFTNIEIYF 76

  Fly    77 GLYKR-------LNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHD--L 132
            .|..|       .:.::|||:.|.||.|||.|:.: |.:|...:.....::|:||||||..:  :
  Fly    77 QLMTRGSESIHAASNWQPFLHTMKLDLCRFWKNHH-NHLARMVFEFIDGHTNMNHTCPYTKEKYI 140

  Fly   133 VLDEMSYHSINYKLTEILPFPEGNYKLEVHWIAYDIDRAITTFYF 177
            .:|:::...::.|:..: |.|:|.|.|...|...:|.|.:|.|||
  Fly   141 SIDDLTNTEVSAKIRGV-PMPKGFYALFTTWSTENITRVVTNFYF 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 27/89 (30%)
CG33914NP_001027394.2 DUF1091 88..166 CDD:461928 25/79 (32%)

Return to query results.
Submit another query.