DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and CG33771

DIOPT Version :9

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027145.3 Gene:CG33771 / 3772424 FlyBaseID:FBgn0053771 Length:178 Species:Drosophila melanogaster


Alignment Length:203 Identity:44/203 - (21%)
Similarity:69/203 - (33%) Gaps:63/203 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KLCVAFQLICIYYLTEV--------------YSLVEFTN----VQCETLDKDFSLFEYCYLQSVN 52
            ||...|.|:.:.:.||:              |:...|.|    :...|::.|..|         |
  Fly     3 KLLTLFLLVQLVFKTEIVVGVSQLFVTGNSSYNPKYFKNFTITIANNTMNMDMHL---------N 58

  Fly    53 RSYKYVSLKVKLLKIPVTK-IKVQFGLYKRLNGYKPF--LYNMTLDGCRFLKSRNPNPIALYFYN 114
            |              |:.: .|....:..||...|.|  :::...|.|....|...:....:|.:
  Fly    59 R--------------PIQRGFKAHVDILLRLANAKNFQSMFSQKSDVCAVTSSVKNSLFKSWFKD 109

  Fly   115 LFKDYSNINHTCP------YNHDLVLDEMSYHSI----NY--KLTEILPFPEGNY--KLEVHWIA 165
            :.|: ||..:.||      |.||..:.....|..    .|  |||    |..|.|  ||....::
  Fly   110 MSKN-SNFMYNCPVEVGHYYMHDWRMGSSMTHKFLIPGEYRGKLT----FFYGKYGTKLFEEALS 169

  Fly   166 YDIDRAIT 173
            ..||..::
  Fly   170 LTIDAILS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 24/100 (24%)
CG33771NP_001027145.3 DM8 80..171 CDD:214778 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447891
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.