DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and CG33792

DIOPT Version :10

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster


Alignment Length:192 Identity:49/192 - (25%)
Similarity:85/192 - (44%) Gaps:31/192 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LIC----IYYLTEVYSLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIK 73
            |:|    |:|....:..:..|  :|......||... |.|:.||.:...:::... :|..:|.||
  Fly    16 LLCLPNTIFYSNGYFFKIRKT--ECIANGAYFSNVS-CILKPVNWTRSVLNMDGD-IKEALTDIK 76

  Fly    74 VQFGLYKR--LNGYKPFLYNMTLDGCRFLKSR-NPNPIALYFYNLFKDYSNINHTCPYNHDLVL- 134
            :...::.:  .|.||||......|.|:.||:: ..|.:..|..:...:::|:||:|||...|.: 
  Fly    77 MSVEVFYKDSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAISHLTEWTNVNHSCPYRVSLCIY 141

  Fly   135 --------DEMSY-----HSI--NYKLTEI-LP-FPEGNYKLEVHWIAYD--IDRAITTFYF 177
                    .|..|     |.|  |::|.|: || .|..:||:..::...:  |...:...||
  Fly   142 NIVKFSQYIEYIYMFLKGHLIARNFRLDEVSLPILPIQDYKIAFNFSGANPGIHLGLVLIYF 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 29/101 (29%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928 29/100 (29%)

Return to query results.
Submit another query.