DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and CG33647

DIOPT Version :10

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027136.1 Gene:CG33647 / 3772049 FlyBaseID:FBgn0053647 Length:190 Species:Drosophila melanogaster


Alignment Length:160 Identity:34/160 - (21%)
Similarity:58/160 - (36%) Gaps:45/160 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CIYYLTEVYSLVEFTNVQC---ETLDKDFSLF-EYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQ 75
            |:.|:.|:     ..||.|   ||.....|:: |:...|.|.      .||              
  Fly    35 CLNYMPEL-----VRNVSCYLNETSHPTGSIYAEFILTQDVE------DLK-------------- 74

  Fly    76 FGLYKRLNGYKPFLYNMT---LDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEM 137
             |:|........::.|.|   :|.|:.|.|...:.:........::.:|....||    |.:::.
  Fly    75 -GIYILTFKRGSYVTNFTSSHVDYCQMLSSVENHFLFRMVTTQLRETANFPIQCP----LKMNKR 134

  Fly   138 SY---HSINYKLTEILP--FPEGNYKLEVH 162
            .|   .::|.|   .:|  .||.|:..:.|
  Fly   135 YYAKGFTVNSK---FIPSYMPETNFISDAH 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 18/88 (20%)
CG33647NP_001027136.1 DUF1091 <95..156 CDD:461928 14/67 (21%)

Return to query results.
Submit another query.