DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and CG33768

DIOPT Version :10

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster


Alignment Length:156 Identity:35/156 - (22%)
Similarity:56/156 - (35%) Gaps:36/156 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCVAFQLICIYYLTEVYSLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTK 71
            :||   |:.|:....|.|.|....||||   |:...|....:.|||.:   :...::||:.....
  Fly     5 VCV---LMVIFVSQAVSSSVTLNRVQCE---KNAKFFATLNVTSVNST---IYADIELLQALKAG 60

  Fly    72 IKVQFGLYKRLNGYKPF--LYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVL 134
            .:....:..||:..|.|  |.....|.|..|.:...:....:..::.|: ||....|        
  Fly    61 FRGHVDVQLRLSNAKKFQSLVQADTDYCELLSTLKDSLFRRWIKSVSKN-SNFMENC-------- 116

  Fly   135 DEMSYHSINYKLTEILPFPEGNYKLE 160
                            |.|.|:|.|:
  Fly   117 ----------------PVPAGHYYLK 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 16/82 (20%)
CG33768NP_001027142.2 DM8 76..167 CDD:214778 14/76 (18%)

Return to query results.
Submit another query.