DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and CG33654

DIOPT Version :9

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001027165.1 Gene:CG33654 / 3771825 FlyBaseID:FBgn0053654 Length:168 Species:Drosophila melanogaster


Alignment Length:157 Identity:85/157 - (54%)
Similarity:112/157 - (71%) Gaps:12/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQFGLYKRLNGYKPF 88
            |..||||:||.:.||.|..|||||::|.||||||::|||.|.|.|            |.|||:||
  Fly    24 SKFEFTNLQCTSFDKSFDDFEYCYIRSANRSYKYLTLKVNLFKTP------------RFNGYRPF 76

  Fly    89 LYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEMSYHSINYKLTEILPFP 153
            ::|:|||.|||||:.:..|||.|||..|..|||:||:||:||||::|::....:|:::|.|||||
  Fly    77 MFNITLDACRFLKNTDSKPIAKYFYEFFNSYSNLNHSCPFNHDLIVDKIPIDFVNHRVTNILPFP 141

  Fly   154 EGNYKLEVHWIAYDIDRAITTFYFAFS 180
            ||:|.||.|||||:||||:...|:..|
  Fly   142 EGDYLLETHWIAYEIDRAMVKIYYTIS 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 44/84 (52%)
CG33654NP_001027165.1 DUF1091 60..147 CDD:284008 50/98 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472034
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.