DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and CG14492

DIOPT Version :9

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster


Alignment Length:175 Identity:37/175 - (21%)
Similarity:74/175 - (42%) Gaps:24/175 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FQLICIYYLTEVYSL---------VEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVK-LL 65
            |.::...||...:.|         ::..|..|.:.|...|:.:. :...:::|.|..:..:: :|
  Fly    10 FWMVIFLYLLPNWKLEAEAKNNFELQTDNFTCSSDDISSSVLKE-FTCGISKSTKRRTWHMEFVL 73

  Fly    66 KIPVTK----IKVQFGLYKRLNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTC 126
            :.||.:    ||:.....:.|..:  .|.|:|.|||:.|.:||..|:.....|:.:.:||....|
  Fly    74 EQPVAEHDFFIKIVLPRRRPLPDF--VLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQC 136

  Fly   127 PYNHDLV-------LDEMSYHSINYKLTEILPFPEGNYKLEVHWI 164
            |:..:..       ||.....:::.:....:.|...|.:..:.||
  Fly   137 PFKPNFTYYIRGFRLDLNLVPAVDMETPVQIEFSHQNKQQGIRWI 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 20/91 (22%)
CG14492NP_611275.2 DM8 95..186 CDD:214778 21/89 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.