DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and CG33137

DIOPT Version :9

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:150 Identity:43/150 - (28%)
Similarity:79/150 - (52%) Gaps:12/150 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IYYLTEVYSLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQFGLYK 80
            |:.|:|...:.:..|::|.|: ..||....|:::::|.:.....:.|.||: |:..|.::|.:.|
  Fly     4 IFQLSEPNIVYKLKNIECSTV-PGFSANASCHIRAINWNKAVAEMDVYLLR-PLYNITIRFQILK 66

  Fly    81 R--LNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEMSYHSIN 143
            :  .|.::|||.::.::.|..|..|:..|..|....:.:.:||.||:|||...| :...:|.:.:
  Fly    67 KDYSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHL-MARGAYLNES 130

  Fly   144 YKLTEILP--FPEGNYKLEV 161
            |     ||  ||.|.||..:
  Fly   131 Y-----LPNVFPLGFYKFNI 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 27/88 (31%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 25/78 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472552
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
43.940

Return to query results.
Submit another query.