DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and CG13198

DIOPT Version :9

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster


Alignment Length:159 Identity:52/159 - (32%)
Similarity:88/159 - (55%) Gaps:12/159 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LVEFTNVQCETL--DKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQFGLYKRLNGYKP 87
            |::||||:|..|  .:..:.:|||:|:.|.|:...:||||.|.::|:..:..:...::|.:||:|
  Fly    24 LLKFTNVKCMDLPTSRGLTKYEYCHLKVVRRNQVELSLKVSLFQLPIRNLTTRLQCFQRRDGYRP 88

  Fly    88 FLYNMTLDGCRFLKSRNPN-PIALYFYNLFKDYSNINHTCPY--NHDLVLDEMSYHSINYKLTEI 149
            |:|.:..|.|:.:.|||.: ....:.::..:..||.|.|||:  ||      |:........|:|
  Fly    89 FMYYILFDFCKLMASRNYDLSFERFIFDAIRKQSNFNQTCPWKENH------MTVEKFALDFTKI 147

  Fly   150 -LPFPEGNYKLEVHWIAYDIDRAITTFYF 177
             :|.|.|.|:|...:.||.|.|.:|..:|
  Fly   148 SMPVPAGTYRLGFTFYAYGIARTLTQVFF 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 26/88 (30%)
CG13198NP_610690.1 DM8 86..179 CDD:214778 31/97 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472132
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.