DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and CG33453

DIOPT Version :9

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:169 Identity:57/169 - (33%)
Similarity:100/169 - (59%) Gaps:11/169 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LICIYYLTEVYSL--VEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTKIKVQ 75
            |..::.::.|...  ::.|||.||:::|.:::|.||.|::.:|:...:::....|. |...:.::
  Fly    12 LAALFLISSVSEAPNIKLTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINATFLH-PTNNVSLR 75

  Fly    76 FGLYKRLNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEMSYH 140
            ..:.|||:||||||:::|:|.|:||:.|: ||:...||:..||||.:||||||...:|.|   ||
  Fly    76 LKMVKRLSGYKPFLFDVTIDACQFLRKRH-NPVIKMFYSFIKDYSTLNHTCPYGLQVVSD---YH 136

  Fly   141 SINYKLTEILPFPEGNYKLEVHWIAYDIDRAITTFYFAF 179
            :..:.    :|.|.|:|.:.:.:|.|...:.....||.|
  Fly   137 TAVFP----VPLPSGDYGVLLDFIFYAKKQFHVNIYFNF 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 37/84 (44%)
CG33453NP_995888.1 DUF1091 74..149 CDD:284008 36/82 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472559
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.