DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and CG33467

DIOPT Version :9

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:154 Identity:43/154 - (27%)
Similarity:77/154 - (50%) Gaps:17/154 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IC-IYYLTEVYSLVEFTNVQC---ETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTK--I 72
            || |.::|:...:.:||.|:|   :...|:.|    |.::.:|.:...|:|...|: .|:..  |
  Fly    11 ICFIGHMTDSQLVYKFTKVECQGNQARVKNVS----CNVKPINWNTALVNLDCYLI-YPLINPTI 70

  Fly    73 KVQFGLYKRLNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEM 137
            :||..:....|.|||||.:.|...|..::.:|..|.|:..:.||:.::|:. :|..:..|.. ..
  Fly    71 RVQVFMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK-SCHISGQLSA-RN 133

  Fly   138 SYHSINYKLTEILPFPEGNYKLEV 161
            .|.:.:|    :.|||.|.|::.|
  Fly   134 GYLNSSY----VPPFPHGQYQISV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 25/84 (30%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472549
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.