DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and CG33467

DIOPT Version :10

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:154 Identity:43/154 - (27%)
Similarity:77/154 - (50%) Gaps:17/154 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IC-IYYLTEVYSLVEFTNVQC---ETLDKDFSLFEYCYLQSVNRSYKYVSLKVKLLKIPVTK--I 72
            || |.::|:...:.:||.|:|   :...|:.|    |.::.:|.:...|:|...|: .|:..  |
  Fly    11 ICFIGHMTDSQLVYKFTKVECQGNQARVKNVS----CNVKPINWNTALVNLDCYLI-YPLINPTI 70

  Fly    73 KVQFGLYKRLNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLFKDYSNINHTCPYNHDLVLDEM 137
            :||..:....|.|||||.:.|...|..::.:|..|.|:..:.||:.::|:. :|..:..|.. ..
  Fly    71 RVQVFMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVWELFQRFTNVK-SCHISGQLSA-RN 133

  Fly   138 SYHSINYKLTEILPFPEGNYKLEV 161
            .|.:.:|    :.|||.|.|::.|
  Fly   134 GYLNSSY----VPPFPHGQYQISV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 23/80 (29%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:461928 26/86 (30%)

Return to query results.
Submit another query.