DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and CG33477

DIOPT Version :9

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster


Alignment Length:182 Identity:36/182 - (19%)
Similarity:63/182 - (34%) Gaps:53/182 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ICIYYLTEVYSLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSLKVK--------LLKIPVT 70
            :|::.|.......|..:|.|..|.|..::.:...:|..|..|...||..:        ..::|.:
  Fly    11 LCLFGLLFFVEEHEVISVICLNLVKYLTIPQPIAVQRGNAEYSLESLDTRCDHDFVEYFHRVPDS 75

  Fly    71 KIKVQFGLYKRLNGYKPFLYNMTL---------------DGCRFLKSRNPNPIALYFYNLFKDYS 120
            ||...|.:.|..   ..|..|:|:               .||.||.    ||:      :||.:.
  Fly    76 KILYTFRVVKLA---PAFTINITIKVLKTHRIMYKIENFKGCEFLN----NPV------IFKMFG 127

  Fly   121 NINHT---------CPYNHDLVLDEMSYHSINYKLTEILP--FPEGNYKLEV 161
            ....|         ||...::      |:.....:..::|  .|.|.::|.:
  Fly   128 ESYKTLVVNGSYFKCPIKPNV------YYLKTDGIMSMIPSVHPFGRFQLSM 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 20/110 (18%)
CG33477NP_995797.1 DUF1091 100..171 CDD:284008 15/86 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.