DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and CG33475

DIOPT Version :10

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_995799.1 Gene:CG33475 / 2768724 FlyBaseID:FBgn0053475 Length:147 Species:Drosophila melanogaster


Alignment Length:126 Identity:29/126 - (23%)
Similarity:44/126 - (34%) Gaps:28/126 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SYKYVSLKVKLLKIPVTKIKVQFGLYKRLNGYKPFLYNM-TLDGCRFLKSRNPNPIALYFYNLFK 117
            |.|.:....||.|......::|..:..|.      :||: .|..|.||.:|..:.:....|..|.
  Fly    27 SQKMMINSTKLFKNIFLDNRIQNAVSNRT------IYNIKNLAICNFLNNRLISKVYSVIYEGFV 85

  Fly   118 DYSNINHTCPYNHDLVLDEMSYHSINYKLTEILPF---------------PEGNYKLEVHW 163
            ..|.: ..||     |...:.|.|.:.:..|:..|               .|||...|:.|
  Fly    86 GNSTV-FRCP-----VQPSVYYLSNSVREFEVPIFHQPGMFRLYVKLKAEKEGNMLTELIW 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 78..159 CDD:461928 21/96 (22%)
CG33475NP_995799.1 DUF1091 52..122 CDD:461928 18/81 (22%)

Return to query results.
Submit another query.