DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33632 and AgaP_AGAP013322

DIOPT Version :9

Sequence 1:NP_001036537.1 Gene:CG33632 / 3885590 FlyBaseID:FBgn0053632 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_003436189.1 Gene:AgaP_AGAP013322 / 11175543 VectorBaseID:AGAP013322 Length:203 Species:Anopheles gambiae


Alignment Length:177 Identity:38/177 - (21%)
Similarity:76/177 - (42%) Gaps:26/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IKLKLCVAFQLICIYYLTEVYSLVEFTNVQCETLDKDFSLFEYCYLQSVNRSYKYVSL------- 60
            :.|::......:.::...:||:...|...:.:.|.:.:::....:| .::..||...|       
Mosquito     2 VHLRIVFLIVGVLLWTCADVYAENVFNYEEQKNLSRPYTIQVQRFL-CIDTPYKETILHECRMIF 65

  Fly    61 ---KVKLLKIPVTK------IKVQFGLYKRLNGYKPFLYNMTLDGCRFLKSRNPNPIALYFYNLF 116
               |..||.|.:..      :.:||.|:.:...|:|||.:...:||..::.|..:|...:.|.:.
Mosquito    66 RRNKRSLLSISLEMPNVYHFLMIQFQLHYKFINYQPFLIDARAEGCDLMRDRKNDPNRHWMYGVI 130

  Fly   117 KD-YSNINHTCPYNHDLVLDEMSYHSINYKLTEILP--FPEGNYKLE 160
            || .|::.|.||:.:      .:|..|.....|..|  .|.|.|:::
Mosquito   131 KDMISSLVHPCPFGN------RTYTQIAMLKEEYAPRSVPAGEYRMD 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33632NP_001036537.1 DUF1091 74..159 CDD:284008 25/87 (29%)
AgaP_AGAP013322XP_003436189.1 DUF1091 88..170 CDD:284008 25/87 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20898
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.