DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and Jon99Fi

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:260 Identity:53/260 - (20%)
Similarity:93/260 - (35%) Gaps:90/260 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LLHTDGSIFCAGTLITDVFILTAASCIR-PNAVKVRLGEFGRYPNELPEDHLV--HYFLMYRLFN 109
            |...:|:.:|.|::|.:.::||||.|.. .:.|.:..|...|  |:....|.|  ..|:.:..:|
  Fly    56 LFSGNGNWWCGGSIIGNTWVLTAAHCTNGASGVTINYGASLR--NQPQYTHWVGSGNFVQHHHYN 118

  Fly   110 NESLANNIGLLK--------LTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGNAW---------- 156
            :.:|.|:|.|::        |..:|::..|        |.:.|..:....:.:.|          
  Fly   119 SGNLHNDISLIRTPHVDFWHLVNKVELPSY--------NDRYQDYAGWWAVASGWGGTYDGSPLP 175

  Fly   157 ----------MEDSNVSLTKELRPIVIQSKPKMCTNLDLYTQFCAGHQGNLRSCDGLTGSALI-- 209
                      |..|:.|.|..|...:|                |....|...:|.|.:|..|:  
  Fly   176 DWLQAVDVQIMSQSDCSRTWSLHDNMI----------------CINTNGGKSTCGGDSGGPLVTH 224

  Fly   210 QNSRYMNKYRHIQFGIAT-VNDMDCEES--------QGYTDVLKFYWWIQDVVSLFNHYSTNESY 265
            :.:|.:        |:.: |:...|:..        .||.|      ||:|        :|..||
  Fly   225 EGNRLV--------GVTSFVSSAGCQSGAPAVFSRVTGYLD------WIRD--------NTGISY 267

  Fly   266  265
              Fly   268  267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 49/245 (20%)
Tryp_SPc 44..249 CDD:214473 47/242 (19%)
Jon99FiNP_651800.2 Tryp_SPc 37..259 CDD:214473 47/242 (19%)
Tryp_SPc 38..262 CDD:238113 50/253 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435971
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.