DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG9737

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:297 Identity:74/297 - (24%)
Similarity:112/297 - (37%) Gaps:94/297 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LYEQCGLM------------REEFSTSLGPWTALL-HTDGSIFCAGTLITDVFILTAASCIRPNA 78
            |..:||..            .:||     ||.||| :......|:|.||.|..|||||.|::...
  Fly   138 LLNECGKQVTNRIYGGEIAELDEF-----PWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEG 197

  Fly    79 VK-------VRLGEFG--------RYPNELP--------EDHLVHYFLMYRLFNNESLANNIGLL 120
            |:       ||||||.        ..||.|.        ....:|....|:.|:|... |:|.::
  Fly   198 VRDRQGLKHVRLGEFNVKTEPDCIEEPNYLSCADAALDIAYEKIHVHPEYKEFSNYKY-NDIAII 261

  Fly   121 KLTKRVQITDYIMPVCIVLNPQNQQLSTM----RFIGNAWMED---------------------- 159
            :|...|..|.::||:|:   |...:..|:    .|..:.|...                      
  Fly   262 RLKHPVSFTHFVMPICL---PNKSEPLTLAEGQMFSVSGWGRTDLFNKYFINIHSPIKLKLRIPY 323

  Fly   160 -SNVSLTKELRPIVIQSKPKMCTNLDLYTQFCAGHQGNLRSCDGLTGSALI----QNSRYMNKYR 219
             ||.:.||.|....::..||         |.|||.:....:|.|.:|..|:    |:||:     
  Fly   324 VSNENCTKILEGFGVRLGPK---------QICAGGEFAKDTCAGDSGGPLMYFDRQHSRW----- 374

  Fly   220 HIQFGIATVNDMDC---EESQGYTDVLKFYWWIQDVV 253
             :.:|:.:.....|   .:...||:|.::..||..||
  Fly   375 -VAYGVVSYGFTQCGMAGKPAVYTNVAEYTDWIDSVV 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 67/265 (25%)
Tryp_SPc 44..249 CDD:214473 65/262 (25%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 67/280 (24%)
Tryp_SPc 150..409 CDD:238113 69/282 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.