DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:295 Identity:62/295 - (21%)
Similarity:94/295 - (31%) Gaps:107/295 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LTISLLASYMLVIYSDSVSANYLYEQCGLMREEFSTSLGPWTALLHTDGSIFCAGTLITDVFILT 69
            :|...|||...|.|...||.|               |.|.|.         :|.|::|...::||
  Fly    41 ITNGNLASEGQVPYIVGVSLN---------------SNGNWW---------WCGGSIIGHTWVLT 81

  Fly    70 AASC--------IRPNAVK---------VRLGEFGRYPNELPEDH--------LVHYFLMYRLFN 109
            ||.|        :...||.         |....|.|||:.:..||        .|.::       
  Fly    82 AAHCTAGADEASLYYGAVNYNEPAFRHTVSSENFIRYPHYVGLDHDLALIKTPHVDFY------- 139

  Fly   110 NESLANNIGLLKLTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGNAWM---------EDSNVSLT 165
              ||.|.|.|..|..|....:                       |.|:         :.|||  .
  Fly   140 --SLVNKIELPSLDDRYNSYE-----------------------NNWVQAAGWGAIYDGSNV--V 177

  Fly   166 KELRPI------VIQSKPKMCTNLDLYTQFCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFG 224
            ::||.:      |.:.:....|:.......|........:|.|.:|..|:      .|......|
  Fly   178 EDLRVVDLKVISVAECQAYYGTDTASENTICVETPDGKATCQGDSGGPLV------TKEGDKLIG 236

  Fly   225 IAT-VNDMDCEES--QGYTDVLKFYWWIQDVVSLF 256
            |.: |:...|:..  .|:|.|.|:..||::...::
  Fly   237 ITSFVSAYGCQVGGPAGFTRVTKYLEWIKEETGIY 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 51/250 (20%)
Tryp_SPc 44..249 CDD:214473 49/247 (20%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 60/286 (21%)
Tryp_SPc 41..266 CDD:238113 62/288 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436136
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.