DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG11843

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001287578.1 Gene:CG11843 / 43432 FlyBaseID:FBgn0039630 Length:316 Species:Drosophila melanogaster


Alignment Length:232 Identity:64/232 - (27%)
Similarity:99/232 - (42%) Gaps:44/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FCAGTLITDVFILTAASCI---RPNAVKVRLGE--FGRYPNE-LPEDHLVHYFLMYRLFNNESLA 114
            ||.|.||::.|:||||.|:   |.....|||||  |.....: .|.|::|..::.:..:.:....
  Fly    98 FCGGVLISERFVLTAAHCLESERGEVNVVRLGELDFDSLDEDAAPRDYMVAGYIAHPGYEDPQFY 162

  Fly   115 NNIGLLKLTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGNAWMEDSNVSLTKELRPIVIQSKPKM 179
            ::|||:|||:.|....|..|.|:   |...:.|:..||...|   .:..|.  |:|.....|.|:
  Fly   163 HDIGLVKLTEAVVFDLYKHPACL---PFQDERSSDSFIAVGW---GSTGLA--LKPSAQLLKVKL 219

  Fly   180 -------CTNL------------DLYTQFCAGHQGNLRSCDGLTGSALIQNSRYMNKY--RHIQF 223
                   |..|            |...|.|.|.:....:|:|.:|..|:.   |..:|  .::..
  Fly   220 QRYGNWVCKKLLTRQVEEFPRGFDGNNQLCVGSEMAQDTCNGDSGGPLLM---YHREYPCMYVVV 281

  Fly   224 GIATVNDMDCEESQG----YTDVLKFYWWIQDVVSLF 256
            ||.:.. :.| .|.|    ||.|..:..||...::.|
  Fly   282 GITSAG-LSC-GSPGIPGIYTRVYPYLGWIARTLATF 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 63/226 (28%)
Tryp_SPc 44..249 CDD:214473 61/223 (27%)
CG11843NP_001287578.1 Tryp_SPc 68..312 CDD:238113 63/226 (28%)
Tryp_SPc 68..309 CDD:214473 61/223 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437586
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.