DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG11842

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_651662.1 Gene:CG11842 / 43431 FlyBaseID:FBgn0039629 Length:319 Species:Drosophila melanogaster


Alignment Length:308 Identity:77/308 - (25%)
Similarity:130/308 - (42%) Gaps:64/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNATLTISLLA--------------SYMLVIYSDSVSANYLYEQCGLMREEFS--TSLGPW---- 45
            :.|.|.:|.:|              :|...::.::...::|.|...::.:...  ||..|.    
  Fly    12 LGAVLLVSFVAWASAQDSDIARTCTAYKRSVWEETSEFSFLIENAPIIYKTLDKCTSYAPLIIGG 76

  Fly    46 -----------TALLHTD--GSI--FCAGTLITDVFILTAASC-IRP-NAVKV-RLG--EFGRYP 90
                       ..|.|.|  |.:  ||.||||:|..:||||.| ..| .:|.: |||  ||....
  Fly    77 GPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHCHYSPQGSVNIARLGDLEFDTNN 141

  Fly    91 NEL-PEDHLVHYFLMYRLFNNESLANNIGLLKLTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGN 154
            ::. |||..|..|..:..|:..::.|:|.:::|::.|...||..|.|:..:  :.:|.| .||..
  Fly   142 DDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPACLPFD--DGRLGT-SFIAI 203

  Fly   155 AWMEDSNVSLT--KELRPIVIQSKPKMC-----------TNLDLYTQFCAGHQGNLRSCDGLTGS 206
            .|.:...|..|  |:|:.:.:.:....|           ...:..||.|.|...:..:|:|.:|.
  Fly   204 GWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRNDELPEGYNATTQLCIGSNEHKDTCNGDSGG 268

  Fly   207 -ALIQNSRYMNKYRHIQFGIATVNDMDCEESQ---GYTDVLKFYWWIQ 250
             .||.:..|...| |: .||.::. :.|:...   .||.|..:..||:
  Fly   269 PVLIYHMDYPCMY-HV-MGITSIG-VACDTPDLPAMYTRVHFYLDWIK 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 68/249 (27%)
Tryp_SPc 44..249 CDD:214473 66/246 (27%)
CG11842NP_651662.1 Tryp_SPc 73..315 CDD:238113 67/247 (27%)
Tryp_SPc 73..312 CDD:214473 65/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.