DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG11841

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_651661.1 Gene:CG11841 / 43430 FlyBaseID:FBgn0039628 Length:319 Species:Drosophila melanogaster


Alignment Length:277 Identity:66/277 - (23%)
Similarity:113/277 - (40%) Gaps:47/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VIYSDSVSANYLYEQCGLMREEFSTSLG----------------PWTALL---HTDGSI--FCAG 59
            :::.:.|:.::.:....:..|...:..|                |:.|.|   .|:..|  ||.|
  Fly    40 IVFEERVAISFFFTDAPITYETVDSCHGSRPLIVDGTPAEPKEFPFAARLGHRKTNNEIKWFCGG 104

  Fly    60 TLITDVFILTAASCI---RPNAVKVRLG--EFGRYPNEL-PEDHLVHYFLMYRLFNNESLANNIG 118
            |||::..:||||.|.   ......||||  ||....::. |||..|.....:..|.|..|.|:||
  Fly   105 TLISNRLVLTAAHCFFSEHGEVNVVRLGELEFDTDTDDAEPEDFGVLALKAHPGFENPQLYNDIG 169

  Fly   119 LLKLTKRVQITDYIMPVCIVLNPQNQQLSTMRFIGNAWMEDSNVSL-TKELRPIVIQSKPKMCTN 182
            :::|.:.|:...|..|.|:..:...|..|   ||...|.:...... :|:|..:.:|.....|.:
  Fly   170 IVQLDREVKFNRYKHPACLPFDDGEQHES---FIAIGWGQKKFAQKESKKLLKVQLQGYKDRCVS 231

  Fly   183 -----------LDLYTQFCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVNDMDC--- 233
                       .:..:|.|.|.:.|..:|:|.:|..::...:.:....|: .||.:.. :.|   
  Fly   232 SVDANDELPNGYEPKSQLCIGSRDNKDTCNGDSGGPVLAYHKDLACMYHV-MGITSAG-ITCSTP 294

  Fly   234 EESQGYTDVLKFYWWIQ 250
            :....||.|..|..||:
  Fly   295 DIPSAYTRVHYFLNWIK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 63/233 (27%)
Tryp_SPc 44..249 CDD:214473 61/230 (27%)
CG11841NP_651661.1 Tryp_SPc 72..311 CDD:238113 62/243 (26%)
Tryp_SPc 72..310 CDD:214473 61/242 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.