DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG31199

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:130 Identity:27/130 - (20%)
Similarity:54/130 - (41%) Gaps:33/130 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YLYEQCGLMREEFSTSLGPWTALLHTDGSIFCAGTLITDVFILTAASCIRPNAVKVRLGEFGRYP 90
            :.:.|...:.|.||..||     :|...:........||.:      |:||:. :::|.|...:|
  Fly    86 HCFVQYNGVAEAFSVHLG-----VHNKSAPVGVRVCETDGY------CVRPSQ-EIKLAEIAIHP 138

  Fly    91 NELPEDHLVHYFLMYRLFNNESLANNIGLLKLTKRVQITDYIMPVCIVLNPQ---NQQLSTMRFI 152
            :                :::.:|.|::.:|.|.:..:|...:||:|  :.|.   |:.|....|:
  Fly   139 D----------------YDSRTLKNSLAVLTLQRDAKIYPNVMPIC--MPPPSLLNETLVAQTFV 185

  Fly   153  152
              Fly   186  185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 21/112 (19%)
Tryp_SPc 44..249 CDD:214473 21/112 (19%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 27/130 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.