DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG5246

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:260 Identity:51/260 - (19%)
Similarity:93/260 - (35%) Gaps:88/260 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TSLGPW-TALLHTDGSIFCAGTLITDVFILTAASCI-----------------RPNAVKVRLGEF 86
            |...|: .::::|.|...|.|::|...:|||||.|:                 ||.|        
  Fly    50 TGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCMEWPIQYLKIVTGTVDYTRPGA-------- 106

  Fly    87 GRYPNELPEDHLVHYFLMYRLFNNESLANNIGLLKLTKRVQITDYIMPVCIVLN---PQNQQLST 148
                     ::||....::...:..:..|:|.|:...|.:...|...|:.:...   |:.....|
  Fly   107 ---------EYLVDGSKIHCSHDKPAYHNDIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLT 162

  Fly   149 MRFIGN--AWMEDSNVSLTKELRPIVIQ-----------------SKPKMCTNLDLYTQFCAGHQ 194
            :...|:  .|...|.     :|:.|.:.                 |:..:||    :||...|  
  Fly   163 LTGWGSTKTWGRYST-----QLQKIDLNYIDHDNCQSRVRNANWLSEGHVCT----FTQEGEG-- 216

  Fly   195 GNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVN-DMDCEESQGYTDVL----KFYWWIQDVVS 254
                ||.|.:|..|:..::.:         :..|| ...|  :.||.||.    .::.||:.:::
  Fly   217 ----SCHGDSGGPLVDANQTL---------VGVVNWGEAC--AIGYPDVFGSVAYYHDWIEQMMT 266

  Fly   255  254
              Fly   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 50/252 (20%)
Tryp_SPc 44..249 CDD:214473 48/249 (19%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 49/253 (19%)
Tryp_SPc 42..263 CDD:238113 51/255 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.