DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG17475

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:226 Identity:51/226 - (22%)
Similarity:88/226 - (38%) Gaps:49/226 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GSIFCAGTLITDVFILTAASCI---RPNAVKVRLG--EFGRYPNEL--PEDHLVHYFLMYRLFNN 110
            |...|.|.:|.:..:||||.|:   .|..::|..|  |:.: |:.:  .|:|.:|.     .:|:
  Fly    72 GGHICGGCIIDERHVLTAAHCVYGYNPTYLRVITGTVEYEK-PDAVYFVEEHWIHC-----NYNS 130

  Fly   111 ESLANNIGLLKLTKRVQITDYIMPVCIVLNP---QNQQLSTMRFIGNAWMEDSNVSLTKELRPIV 172
            ....|:|.|::|...::..:|..|..:...|   ..|.|.|.......|.:..:: |.|.....|
  Fly   131 PDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDI-LQKAYLTHV 194

  Fly   173 IQSKPKMCTNLDLYTQFC------AGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIAT---- 227
            :.|..:...|.|.....|      .|.||   :|.|.:|..|..|.        :.:|:..    
  Fly   195 VYSTCQEIMNNDPSNGPCHICTLTTGGQG---ACHGDSGGPLTHNG--------VLYGLVNWGYP 248

  Fly   228 ----VNDMDCEESQGYTDVLKFYWWIQDVVS 254
                |.|       .:.:|..:..||:.::|
  Fly   249 CALGVPD-------SHANVYYYLEWIRSMIS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 50/222 (23%)
Tryp_SPc 44..249 CDD:214473 48/219 (22%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 48/219 (22%)
Tryp_SPc 50..269 CDD:238113 50/221 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.