DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG31265

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:268 Identity:57/268 - (21%)
Similarity:98/268 - (36%) Gaps:67/268 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QCGLMR--EEFSTSLGPW-TALLHTDGSIFCAGTLITDVFILTAASCIR---PNAVKVRLGEFGR 88
            |.|.::  ||......|: .:|....||..|.|.::.:.:|:||..|:.   |..|.|..|    
  Fly    33 QSGRIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNENWIITAGHCVENFIPALVNVITG---- 93

  Fly    89 YPNELPEDHLVHY---FLMYRLFNNESLANNIGLLKLTKRVQITDYIMPVCIVLNPQNQQLSTMR 150
             .|:..|...::|   ...:.:::...:.|:|.|:|||:.:...:...|:.:...|  .||.. .
  Fly    94 -TNKWAEPGAIYYTAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALPTRP--VQLGE-E 154

  Fly   151 FIGNAW---------MEDSNVSLTKELRPIVIQSKPKMCTNLDLYTQF-----------CAGHQG 195
            .:...|         |||.: .||..|.|:.           :.|..|           |...:.
  Fly   155 IVLTGWGSDVAYGSSMEDLH-KLTVGLVPLD-----------ECYETFNRTSSMGVGHICTFSRE 207

  Fly   196 NLRSCDGLTGSALIQNSR---YMNKYRHIQFGIATVNDMDCEESQGYTDVLKFYWWIQDVVSLFN 257
            ...:|.|.:|..|:.|.:   .:|..|....|:..|.          .:|..:..||:..:|   
  Fly   208 GEGACHGDSGGPLVSNGQLVGVVNWGRPCGVGLPDVQ----------ANVYYYLDWIRSKLS--- 259

  Fly   258 HYSTNESY 265
              ..|:.|
  Fly   260 --GNNKCY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 50/237 (21%)
Tryp_SPc 44..249 CDD:214473 48/234 (21%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 50/247 (20%)
Tryp_SPc 39..257 CDD:238113 52/247 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.