DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG3505

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:286 Identity:68/286 - (23%)
Similarity:113/286 - (39%) Gaps:86/286 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LYEQCGLMREEFSTSLG------PWTALL-HTDGS----IFCAGTLITDVFILTAASCIRPNAVK 80
            |...||.:|.:.|....      ||.||: :|.|:    ..|.|.||:|.::||||.|:...|..
  Fly    96 LPSDCGKVRWQRSNDTDTRIREFPWLALIEYTRGNQEKIHACGGVLISDRYVLTAAHCVAQAATS 160

  Fly    81 ------VRLGEFGRYPNE-------------LP--EDHLVHYFLMYRLFN--NESLANNIGLLKL 122
                  |||||:....|.             .|  :|..:...|.:.|:|  :.:..|:|.|::|
  Fly   161 NLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQDIAIEELLPHPLYNRTDRTQINDIALVRL 225

  Fly   123 TKRVQITDYIMPVCIVLNPQNQ----------------QLSTMRFIGNAWMEDSNVS------LT 165
            ....::.|::.|:|:   |..|                |.|:.:.:...::..|::.      .:
  Fly   226 ASPAKLNDFVQPICL---PNKQLRADELEDLVTEVAGWQASSSQRMRKGYVTISSIEECQRKYAS 287

  Fly   166 KELRPIVIQSKPKMC--TNLDLYTQFCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATV 228
            ::||   ||:. |:|  ||    :|.|.|:.|.        ...|.:|..|      :..|:.:.
  Fly   288 QQLR---IQAS-KLCGLTN----SQECYGNAGG--------PLMLFKNDGY------LLGGLVSF 330

  Fly   229 NDMDCEESQG---YTDVLKFYWWIQD 251
            ..:.|.....   ||.|..:..||.|
  Fly   331 GPVPCPNPDWPDVYTRVASYIDWIHD 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 63/263 (24%)
Tryp_SPc 44..249 CDD:214473 60/259 (23%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855
Tryp_SPc 111..356 CDD:238113 62/269 (23%)
Tryp_SPc 111..354 CDD:214473 60/267 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.