DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG31326

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:283 Identity:64/283 - (22%)
Similarity:105/283 - (37%) Gaps:93/283 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 CGLMREEFST--------SLG----PWTALL----HTDGSIF-CAGTLITDVFILTAASCIRP-- 76
            ||  ||..||        ||.    ||...:    .::|..| |.||||:...:|:||.|.|.  
  Fly   263 CG--RERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPG 325

  Fly    77 --------------NAVKVRL-GEFGRYPNELPEDHLVHYFLMYRLFNNESLANNIGLLKLTKRV 126
                          |.:.:.. ||| |..::|    ::|....::.|....||    |::|.:.|
  Fly   326 RDLPASRLAVSLGRNTLAIHSDGEF-RGVSQL----IIHENFQFKQFTEADLA----LVRLDEPV 381

  Fly   127 QITDYIMPVCIVLNPQNQQLSTMRFIGNAWMEDSNVSLTKELRPIVI----------QSKPKMCT 181
            :.||||:|:|:                  |...:.:.|.:.|:..|.          .::....|
  Fly   382 RYTDYIVPICL------------------WSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVT 428

  Fly   182 NLDLYTQ----------------FCAGHQGNLRSCDGLTGSALIQNSRYMNKYRH-IQFGIATVN 229
            :|::.::                .||...| ...|....|..|:...:.:...|. |..|:....
  Fly   429 DLNIVSEANCALELPHVLVQPSSLCAKKTG-AGPCASDGGGPLMLREQDVWVLRGVISGGVINEK 492

  Fly   230 DMDCEESQG--YTDVLKFYWWIQ 250
            :..||.|:.  :|||.|...|::
  Fly   493 ENTCELSKPSVFTDVAKHIEWVR 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 56/258 (22%)
Tryp_SPc 44..249 CDD:214473 55/255 (22%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 58/267 (22%)
Tryp_SPc 277..514 CDD:214473 57/264 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436565
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.