DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG8870

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:284 Identity:72/284 - (25%)
Similarity:113/284 - (39%) Gaps:75/284 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YL-YEQCGLMR-----------EEFSTSLGPWTALLHTDGSIF-------------CAGTLITDV 65
            || ::.||..|           .||     ||.|:|     ::             |.|:||.:.
  Fly    71 YLPHDTCGQSRRKPTKGKIPALNEF-----PWMAML-----LYGNKNNLSQKLVPKCGGSLINNW 125

  Fly    66 FILTAASCIR------PNAVK-VRLGEFGRYPNELPEDHLVH---------------YFLMYRLF 108
            ::||||.|:.      |.|:| |||||.....|  |:..:|:               ..:.:..|
  Fly   126 YVLTAAHCVEYPFMDYPYALKTVRLGEHNTSTN--PDRAIVNGRRQYAPLYMEIEVDQIITHEQF 188

  Fly   109 N-NESLANNIGLLKLTKRVQITDYIMPVCIVLNPQNQQLST--MRFIGNAWMEDSNVSLTKE--L 168
            | ...|.|:|.|::|...|:.|..|.|:|:   |:.|:|:.  .:|..:.| .|....:..|  |
  Fly   189 NRGRRLINDIALVRLKFPVRYTRAIQPICL---PRAQKLAAHKRKFQASGW-PDMGQGIASEVLL 249

  Fly   169 RPIVIQSKPKMC-TNLD--LYTQFCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVND 230
            |..:.:..|.:| :|.|  |.:|.|||......:..|.:|..|::.............||.:...
  Fly   250 RSFIAERHPDVCKSNYDFNLGSQICAGGLDGNDTSPGDSGGPLMETVIRGKVTLTYAAGIISYGQ 314

  Fly   231 MDCE----ESQGYTDVLKFYWWIQ 250
            ..|.    :...||....|:.||:
  Fly   315 KPCVLKTCKPAFYTKTSYFFEWIK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 65/254 (26%)
Tryp_SPc 44..249 CDD:214473 63/251 (25%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 67/262 (26%)
Tryp_SPc 93..337 CDD:214473 65/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463513
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.