DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG13318

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:307 Identity:75/307 - (24%)
Similarity:111/307 - (36%) Gaps:85/307 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TLTISLLASYMLVIYSDSVSANYLYEQCGLMREEF------------STSLG--PWTALLHTDGS 54
            |.:.:|..||.||....:.|     .|||   ..|            ..|.|  ||.|.|.|...
  Fly   129 TTSSTLTCSYGLVACCQAGS-----YQCG---RRFPPPPGSTTAAPGQASFGAYPWQAALLTTAD 185

  Fly    55 IFC-AGTLITDVFILTAASCIRPNAV---KVRLGEFGRYPNELP---EDHLVHYFLMYRLFNNES 112
            ::. .|.|||...:||||..:....:   ||||||:.......|   :|..:....:...||..:
  Fly   186 VYLGGGALITAQHVLTAAHKVYNLGLTYFKVRLGEWDAASTSEPIPAQDVYISNVYVNPSFNPNN 250

  Fly   113 LANNIGLLKLTKRVQIT--DYIMPVCIVLNPQNQQLSTMRFIG-NAWME---DSNVSLTKELRPI 171
            |.|::.:|||:..|.:|  ..:..||         |.|..|:| ..|:.   .::...|...:.|
  Fly   251 LQNDVAILKLSTPVSLTSKSTVGTVC---------LPTTSFVGQRCWVAGWGKNDFGATGAYQAI 306

  Fly   172 VIQSKPKMCTNLDLY----------------TQF-CAGHQGNLRSCDGLTGSALIQNSRYMNKYR 219
            ..|....:..|.:..                |.| |||.:....:|.|..||.|:..|   |...
  Fly   307 ERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDACTGDGGSPLVCTS---NGVW 368

  Fly   220 HI-----------QFGIATVNDMDCEESQGYTDVLKFYWWIQDVVSL 255
            ::           |.|:..|          |.:|..:..|||..::|
  Fly   369 YVVGLVAWGIGCAQAGVPGV----------YVNVGTYLPWIQTTLTL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 61/248 (25%)
Tryp_SPc 44..249 CDD:214473 58/245 (24%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 63/254 (25%)
Tryp_SPc 169..399 CDD:214473 60/251 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435536
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.