DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33460 and CG11529

DIOPT Version :9

Sequence 1:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:283 Identity:73/283 - (25%)
Similarity:118/283 - (41%) Gaps:50/283 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LASYMLVIYSDSVSANYLYEQCGLMR-EEFSTSLGPWTALLHTDGS------IFCAGTLITDVFI 67
            ||..||:::..:.:.:|...|....| |:|     |:..:|  .|.      |.|.|||:...:|
  Fly    12 LAVIMLMMWKPTPTDSYAVGQSKYGRIEKF-----PYQVML--IGKQLWRKRILCGGTLLDKRWI 69

  Fly    68 LTAASC-IRPNAVKVRLGEFGRYPNELPEDHLV--------HYFLMYRLFNNESLANNIGLLKLT 123
            |||..| :......|.||      .:..||..|        :.|:::..||.|:.||:|.|:||.
  Fly    70 LTAGHCTMGVTHYDVYLG------TKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLP 128

  Fly   124 KRVQITDYIMPVCIVLNPQNQQLSTMRFIGNAW-----MEDSNVSLTKELRPIVIQSKPKMCTNL 183
            :.|..|..|.|..:....::.|.:.|..:.:.|     |.:|:.....||:.|   |..:.....
  Fly   129 QDVAFTPRIQPASLPSRYRHDQFAGMSVVASGWGAMVEMTNSDSMQYTELKVI---SNAECAQEY 190

  Fly   184 DLYTQ--FCAGHQGNLRSCDGLTGSALIQNSRYMNKYRHIQFGIATVNDMD-CEES--QGYTDVL 243
            |:.|.  .||....:...|.|.:|..|:.      |...|..||.:....| ||.:  .|:|.|.
  Fly   191 DVVTSGVICAKGLKDETVCTGDSGGPLVL------KDTQIVVGITSFGPADGCETNIPGGFTRVT 249

  Fly   244 KFYWWIQDVVSLFNHYSTNESYI 266
            .:..||:..:.  :|...::.|:
  Fly   250 HYLDWIESKIG--SHGQVHQQYL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 62/232 (27%)
Tryp_SPc 44..249 CDD:214473 60/229 (26%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 65/242 (27%)
Tryp_SPc 37..255 CDD:214473 63/239 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.